Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZIC4 Peptide - C-terminal region

ZIC4 Peptide - C-terminal region

Product Specifications

Product Name Alternative

ZIC4

UniProt

Q8N9L1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZIC4 Rabbit Polyclonal Antibody (orb573569) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_115529

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDSATPSAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat ICAM1 Recombinant Rabbit monoclonal Antibody
HA723927 100 µL

Rat ICAM1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Haze Meter BMET-1207
BMET-1207 1 Unit

Haze Meter BMET-1207

Sign In for Pricing
View Details
ErbB4 Recombinant Rabbit Monoclonal Antibody [JE59-43]
HA721720 100 µL

ErbB4 Recombinant Rabbit Monoclonal Antibody [JE59-43]

Sign In for Pricing
View Details
2-Amino-5-isopropylbenzoic acid
TRC-A637498-100MG 100 mg

2-Amino-5-isopropylbenzoic acid

Sign In for Pricing
View Details
Semaphorin 3B (SEMA3B) Human Gene Knockout Kit (CRISPR)
KN402875 1 Kit

Semaphorin 3B (SEMA3B) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MGP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D6]
TA806528BM 100 µL

MGP Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8D6]

Sign In for Pricing
View Details