Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERF1 Peptide - C-terminal region

TERF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TERF1, PIN2, TRBF1, TRF, TRF1

UniProt

P54274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TERF1 Rabbit Polyclonal Antibody (orb573631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059523

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), Biotin conjugate, 0.1mg/mL
BNCB2243-100 1x 100 µL

Glutathione S-Transferase Mu3 (GSTM3) (CPTC-GSTMu3-1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Uqcr11 activation kit by CRISPRa
GA206858 1 Kit

Mouse Uqcr11 activation kit by CRISPRa

Sign In for Pricing
View Details
p16INK4a Recombinant Rabbit monoclonal Antibody [SU0702]
ET1608-62-50UL 50 µL

p16INK4a Recombinant Rabbit monoclonal Antibody [SU0702]

Sign In for Pricing
View Details
Human MIF4GD activation kit by CRISPRa
GA111486 1 Kit

Human MIF4GD activation kit by CRISPRa

Sign In for Pricing
View Details
NDFIP1 Human Gene Knockout Kit (CRISPR)
KN402574 1 Kit

NDFIP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CCNL1 Rabbit Polyclonal Antibody
AP06277PU-N 100 µg

CCNL1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details