Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TERF1 Peptide - C-terminal region

TERF1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TERF1, PIN2, TRBF1, TRF, TRF1

UniProt

P54274

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TERF1 Rabbit Polyclonal Antibody (orb573631) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_059523

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTMKKLKLISSDSED

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human COL11A1 activation kit by CRISPRa
GA100915 1 Kit

Human COL11A1 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)
PKSQ050030-01 10 µg

Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)

Sign In for Pricing
View Details
Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)
PKSQ050030-02 50 µg

Recombinant Cynomolgus CD3e/CD3ε Protein (Fc Tag)

Sign In for Pricing
View Details
Mouse Icmt activation kit by CRISPRa
GA206157 1 Kit

Mouse Icmt activation kit by CRISPRa

Sign In for Pricing
View Details
FITC Conjugated Helix pomatia Lectin (Edible Snail) -HPA-
F-3601-1 1 mg

FITC Conjugated Helix pomatia Lectin (Edible Snail) -HPA-

Sign In for Pricing
View Details
Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)
KN209258LP 1 Kit

Niemann Pick C1 (NPC1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details