Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF3R Peptide - N-terminal region

CSF3R Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSF3R, GCSFR

UniProt

Q99062

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSF3R Rabbit Polyclonal Antibody (orb574836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Polyclonal ORP8 Antibody
H00114882-B01P 0.05 mg

Mouse Polyclonal ORP8 Antibody

Sign In for Pricing
View Details
CTRP5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-11717R-BF555 100 µL

CTRP5 Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
MOBKL2B (MOB3B) (NM_024761) Human Tagged Lenti ORF Clone
RC205977L3 10 µg

MOBKL2B (MOB3B) (NM_024761) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Fish 5-hydroxytryptamine/serotonin (5HT/ST) ELISA Kit
orb1655901-01 48 Tests

Fish 5-hydroxytryptamine/serotonin (5HT/ST) ELISA Kit

Sign In for Pricing
View Details
Fish 5-hydroxytryptamine/serotonin (5HT/ST) ELISA Kit
orb1655901-02 96 Tests

Fish 5-hydroxytryptamine/serotonin (5HT/ST) ELISA Kit

Sign In for Pricing
View Details
Recombinant human MIA Protein (HEK293)
orb2328511-01 20 µg

Recombinant human MIA Protein (HEK293)

Sign In for Pricing
View Details