Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CSF3R Peptide - N-terminal region

CSF3R Peptide - N-terminal region

Product Specifications

Product Name Alternative

CSF3R, GCSFR

UniProt

Q99062

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CSF3R Rabbit Polyclonal Antibody (orb574836) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: HNLSCLMNLTTSSLICQWEPGPETHLPTSFTLKSFKSRGNCQTQGDSILD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ROS Antibody (OTI1A1) [Alexa Fluor 647]
NBP2-73933AF647 0.1 mL

Mouse Monoclonal ROS Antibody (OTI1A1) [Alexa Fluor 647]

Sign In for Pricing
View Details
Recombinant Human SULT1E1 Protein, N-His
YHE72601 100 μg

Recombinant Human SULT1E1 Protein, N-His

Sign In for Pricing
View Details
Hepatitis C Virus, Combined, Recombinant (HCV Nucleocapsid, NS3, NS4, NS5)
MBS637473-01 0.1 mg

Hepatitis C Virus, Combined, Recombinant (HCV Nucleocapsid, NS3, NS4, NS5)

Sign In for Pricing
View Details
Hepatitis C Virus, Combined, Recombinant (HCV Nucleocapsid, NS3, NS4, NS5)
MBS637473-02 0.5 mg

Hepatitis C Virus, Combined, Recombinant (HCV Nucleocapsid, NS3, NS4, NS5)

Sign In for Pricing
View Details
Hepatitis C Virus, Combined, Recombinant (HCV Nucleocapsid, NS3, NS4, NS5)
MBS637473-03 5x 0.5 mg

Hepatitis C Virus, Combined, Recombinant (HCV Nucleocapsid, NS3, NS4, NS5)

Sign In for Pricing
View Details
UFM1 Polyclonal Antibody
E915843 100 µL

UFM1 Polyclonal Antibody

Sign In for Pricing
View Details