SNCB Peptide - C-terminal region
SNCB Peptide - C-terminal region
Product Specifications
UniProt
Q16143
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SNCB Rabbit Polyclonal Antibody (orb324497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
XP_006714979
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0521-500 1x 500 µL
AFP (Alpha Fetoprotein) (MBS-12), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
E-UNEL-M0124-01 5x 96 Tests
Uncoated Mouse MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details E-UNEL-M0124-02 15x 96 Tests
Uncoated Mouse MCP-3 (Monocyte Chemotactic Protein 3) ELISA Kit
Sign In for Pricing
View Details 
BNC470023-500 1x 500 µL
Thyroglobulin (2H11), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 