Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNCB Peptide - C-terminal region

SNCB Peptide - C-terminal region

Product Specifications

UniProt

Q16143

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNCB Rabbit Polyclonal Antibody (orb324497) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006714979

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLVKREEFPTDLKPEEVAQEAAEEPLIEPLMEPEGESYEDPPQEEYQEYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R,S)-N-Ethyl Nornicotine
TRC-E925300-5MG 5 mg

(R,S)-N-Ethyl Nornicotine

Sign In for Pricing
View Details
ANXA9 Human Gene Knockout Kit (CRISPR)
KN400554 1 Kit

ANXA9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant TOP1 Antibody
RC-006-01 50 μL

Recombinant TOP1 Antibody

Sign In for Pricing
View Details
Recombinant TOP1 Antibody
RC-006-02 100 µL

Recombinant TOP1 Antibody

Sign In for Pricing
View Details
Recombinant TOP1 Antibody
RC-006-03 1 mL

Recombinant TOP1 Antibody

Sign In for Pricing
View Details
SYCE2 (NM_001105578) Human Recombinant Protein
TP325261L 1 mg

SYCE2 (NM_001105578) Human Recombinant Protein

Sign In for Pricing
View Details