TRIM52 Peptide - N-terminal region
TRIM52 Peptide - N-terminal region
Product Specifications
Product Name Alternative
RNF102
UniProt
Q96A61
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM52 Rabbit Polyclonal Antibody (orb324581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_116154
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: ML2]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd651/imageurl/am39019ac-n.webp)
AM39019AC-N 100 Tests
CD45 (PTPRC) Mouse Monoclonal Antibody [Clone ID: ML2]
Sign In for Pricing
View Details 
TP762740 50 µg
Prealbumin (TTR) (NM_000371) Human Recombinant Protein
Sign In for Pricing
View Details ![DUSP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H9]](https://cdn.genprice.uk/products/937/68dd1b85061270361ea1fe6f/imageurl/ta811007bm.webp)
TA811007BM 100 µL
DUSP5 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5H9]
Sign In for Pricing
View Details