Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM52 Peptide - N-terminal region

TRIM52 Peptide - N-terminal region

Product Specifications

Product Name Alternative

RNF102

UniProt

Q96A61

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM52 Rabbit Polyclonal Antibody (orb324581) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_116154

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DGWDGSIREVLYRGNADEELFQDQDDDELWLGDSGITNWDNVDYMWDEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EAAC1 Antibody: ATTO 594
SMC-406D-A594 100 µg

EAAC1 Antibody: ATTO 594

Sign In for Pricing
View Details
NSE (ENO2) Rabbit Polyclonal Antibody
AP12427PU-N 400 µL

NSE (ENO2) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tnf Mouse Gene Knockout Kit (CRISPR)
KN517964 1 Kit

Tnf Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GFAP (GA-5), CF647 conjugate, 0.1mg/mL
BNC470167-100 1x 100 µL

GFAP (GA-5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant UCHL3 Antibody
RC-15316-01 50 μL

Recombinant UCHL3 Antibody

Sign In for Pricing
View Details
Recombinant UCHL3 Antibody
RC-15316-02 100 µL

Recombinant UCHL3 Antibody

Sign In for Pricing
View Details