Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM40 Peptide - C-terminal region

TRIM40 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RNF35

UniProt

Q6P9F5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM40 Rabbit Polyclonal Antibody (orb324582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (C2) [HRP]
NBP2-48016H 0.1 mL

Mouse Monoclonal alpha-Fetoprotein/AFP Antibody (C2) [HRP]

Sign In for Pricing
View Details
Recombinant Candida Albicans AIM23 Protein (aa 19-432)
VAng-Lsx05275-1mgEcoli 1 mg (E. coli)

Recombinant Candida Albicans AIM23 Protein (aa 19-432)

Sign In for Pricing
View Details
RAB29 Antibody
CSB-PA003898-01 50 µg

RAB29 Antibody

Sign In for Pricing
View Details
RAB29 Antibody
CSB-PA003898-02 100 µg

RAB29 Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW)
MBS7034344-01 0.02 mg

Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW)

Sign In for Pricing
View Details
Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW)
MBS7034344-02 0.1 mg

Recombinant Escherichia coli Putative osmoprotectant uptake system permease protein yehW (yehW)

Sign In for Pricing
View Details