Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TRIM40 Peptide - C-terminal region

TRIM40 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RNF35

UniProt

Q6P9F5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TRIM40 Rabbit Polyclonal Antibody (orb324582) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ISRAVTQLRSLVIDLERTAKELDTNTLKNAGDLLNRSAPQKLEVIYPQLE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Vamp5 shRNA (UAS) - Lentiviral mouseVamp5 shRNA (UAS, GFP) (25)
GTR15195860 1 Vial

Lentiviral mouse Vamp5 shRNA (UAS) - Lentiviral mouseVamp5 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
AKAP7 Antibody, Biotin conjugated
MBS1495849-01 0.05 mg

AKAP7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
AKAP7 Antibody, Biotin conjugated
MBS1495849-02 0.1 mg

AKAP7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
AKAP7 Antibody, Biotin conjugated
MBS1495849-03 5x 0.1 mg

AKAP7 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Lentiviral human CCDC153 sgRNA gene knockout kit - Lentiviral human CCDC153 sgRNA gene knockout kit (25)
GTR15386253 1 Vial

Lentiviral human CCDC153 sgRNA gene knockout kit - Lentiviral human CCDC153 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rat Ureteral Epithelial Cell Complete Medium
MBS2577206-01 100 mL

Rat Ureteral Epithelial Cell Complete Medium

Sign In for Pricing
View Details