Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PLA2G4B Peptide - C-terminal region

PLA2G4B Peptide - C-terminal region

Product Specifications

Product Name Alternative

HsT16992, cPLA2-beta

UniProt

P0C869

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PLA2G4B Rabbit Polyclonal Antibody (orb324760) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005081

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal ETS2 Antibody (OTI2A3) [DyLight 550]
NBP2-70694R 0.1 mL

Mouse Monoclonal ETS2 Antibody (OTI2A3) [DyLight 550]

Sign In for Pricing
View Details
Acbd3 Antibody - middle region
ARP57650_P050-25UL 25 µL

Acbd3 Antibody - middle region

Sign In for Pricing
View Details
C22orf27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV814584 1.0 µg DNA

C22orf27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
HDAC8
CSB-CL010244HU 10 μg Plasmid + 200 μL Glycerol

HDAC8

Sign In for Pricing
View Details
ARL13B (NM_182896) Human Over-expression Lysate
LY405389 100 µg

ARL13B (NM_182896) Human Over-expression Lysate

Sign In for Pricing
View Details
Zfp672 ORF Vector (Mouse) (pORF)
ORF062501 1.0 µg DNA

Zfp672 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details