TRIM55 Peptide - middle region
TRIM55 Peptide - middle region
Product Specifications
Product Name Alternative
RNF29, muRF2, MURF-2
UniProt
Q9BYV6
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM55 Rabbit Polyclonal Antibody (orb325082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![3,3-Dimethyl-1-[2- (trifluoromethyl) phenyl]butan-2-amine hydrochloride](https://cdn.genprice.uk/genprice/uk/genprice5.webp)
DXC58422-01 50 mg
3,3-Dimethyl-1-[2- (trifluoromethyl) phenyl]butan-2-amine hydrochloride
Sign In for Pricing
View Details DXC58422-02 0.5 g
3,3-Dimethyl-1-[2- (trifluoromethyl) phenyl]butan-2-amine hydrochloride
Sign In for Pricing
View Details GTR15140424 1 Vial
Lentiviral mouse Msi2 shRNA (UAS) - Lentiviral mouse Msi2 shRNA (UAS, RFP) (100)
Sign In for Pricing
View Details 
orb2906070-01 20 µg
Recombinant Pig Melanocyte-stimulating hormone receptor (MC1R)
Sign In for Pricing
View Details orb2906070-02 100 µg
Recombinant Pig Melanocyte-stimulating hormone receptor (MC1R)
Sign In for Pricing
View Details 
A03358-1-APC 100 µg/Vial
Anti-INPP5D Antibody Picoband®, APC Conjugate
Sign In for Pricing
View Details