TRIM55 Peptide - middle region
TRIM55 Peptide - middle region
Product Specifications
Product Name Alternative
RNF29, muRF2, MURF-2
UniProt
Q9BYV6
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TRIM55 Rabbit Polyclonal Antibody (orb325082) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: EHGYENMNHFTVNLNREEKIIREIDFYREDEDEEEEEGGEGEKEGEGEVG
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUM2333-50 1x 50 µL
Cyclin A2 (S- & G2-phase Cyclin) (CCNA2/2333), 1mg/mL
Sign In for Pricing
View Details 
#30097 1 Kit
MemBrite® Fix 640/660 Cell Surface Staining Kit, 500 Reactions
Sign In for Pricing
View Details 
BNC740103-100 1x 100 µL
P55;50 EBV-Early Antigen (1108-1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681825-100 1x 100 µL
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/1825R), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042609-100 1x 100 µL
NRF1 (NRF1/2609), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042307-500 1x 500 µL
Moesin (rMSN/492), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details