Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC17A7 Peptide - N-terminal region

SLC17A7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BNPI, VGLUT1

UniProt

Q9P2U7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC17A7 Rabbit Polyclonal Antibody (orb325118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064705

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKSG24 (MPV17L2) (NM_032683) Human Recombinant Protein
TP310560L 1 mg

FKSG24 (MPV17L2) (NM_032683) Human Recombinant Protein

Sign In for Pricing
View Details
Unknown Specificity (Isotype control) Recombinant Antibody [MOPC-21] (OAAV00179)
OAAV00645-200UG 200 µg

Unknown Specificity (Isotype control) Recombinant Antibody [MOPC-21] (OAAV00179)

Sign In for Pricing
View Details
Recombinant Human RAB9A Protein, N-His
orb3058279-01 50 µg

Recombinant Human RAB9A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RAB9A Protein, N-His
orb3058279-02 100 µg

Recombinant Human RAB9A Protein, N-His

Sign In for Pricing
View Details
Recombinant Human RAB9A Protein, N-His
orb3058279-03 1 mg

Recombinant Human RAB9A Protein, N-His

Sign In for Pricing
View Details
CCT8L2 3'UTR GFP Stable Cell Line
TU053850 1.0 mL

CCT8L2 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details