Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC17A7 Peptide - N-terminal region

SLC17A7 Peptide - N-terminal region

Product Specifications

Product Name Alternative

BNPI, VGLUT1

UniProt

Q9P2U7

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC17A7 Rabbit Polyclonal Antibody (orb325118) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064705

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GLGFCISFGIRCNLGVAIVSMVNNSTTHRGGHVVVQKAQFSWDPETVGLI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tph2 ELISA Kit
ELI-07130r 96 Tests

Rat Tph2 ELISA Kit

Sign In for Pricing
View Details
Human Olfactory receptor 2B6 (OR2B6) ELISA kit
GTR10378512 96 Well

Human Olfactory receptor 2B6 (OR2B6) ELISA kit

Sign In for Pricing
View Details
Nectin 2 (NECTIN2) (NM_002856) Human Tagged Lenti ORF Clone
RC200286L1 10 µg

Nectin 2 (NECTIN2) (NM_002856) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Equine Cluster of Differentiation 8 (CD8) ELISA Kit-Sandwich
EK1F93-01 48 Test

Equine Cluster of Differentiation 8 (CD8) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Equine Cluster of Differentiation 8 (CD8) ELISA Kit-Sandwich
EK1F93-02 96 Tests

Equine Cluster of Differentiation 8 (CD8) ELISA Kit-Sandwich

Sign In for Pricing
View Details
DMC1 (Meiotic Recombination Protein DMC1/LIM15 Homolog, DMC1H, LIM15) (Biotin)
125905-Biotin 100 µL

DMC1 (Meiotic Recombination Protein DMC1/LIM15 Homolog, DMC1H, LIM15) (Biotin)

Sign In for Pricing
View Details