Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF Peptide - C-terminal region

TNF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DIF, TNFA, TNFSF2, TNLG1F, TNF-alpha

UniProt

P01375

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNF Rabbit Polyclonal Antibody (orb325138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000585

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(1Alpha,3Beta,10Alpha)-Cholesta-5,7-diene-1,3,25-triol
TRC-C431405-5MG 5 mg

(1Alpha,3Beta,10Alpha)-Cholesta-5,7-diene-1,3,25-triol

Sign In for Pricing
View Details
HPV11 E7 Protein (1-35) Mouse Monoclonal Antibody [Clone ID: 8G6]
AM26114PU-N 100 µg

HPV11 E7 Protein (1-35) Mouse Monoclonal Antibody [Clone ID: 8G6]

Sign In for Pricing
View Details
Calponin-1 (CNN1/832), CF594 conjugate, 0.1mg/mL
BNC940832-100 1x 100 µL

Calponin-1 (CNN1/832), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ret Recombinant Rabbit monoclonal Antibody
HA750280 100 µL

Ret Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Rat Ager protein (His tag)
PDMR100078-01 20 µg

Recombinant Rat Ager protein (His tag)

Sign In for Pricing
View Details
Recombinant Rat Ager protein (His tag)
PDMR100078-02 100 µg

Recombinant Rat Ager protein (His tag)

Sign In for Pricing
View Details