Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TNF Peptide - C-terminal region

TNF Peptide - C-terminal region

Product Specifications

Product Name Alternative

DIF, TNFA, TNFSF2, TNLG1F, TNF-alpha

UniProt

P01375

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TNF Rabbit Polyclonal Antibody (orb325138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000585

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TIM10| Mitochondrial import inner membrane translocase subunit TIM10
AS23 4950 50 µg

Anti-TIM10| Mitochondrial import inner membrane translocase subunit TIM10

Sign In for Pricing
View Details
TBX6 (C-term) Rabbit Polyclonal Antibody
AP54189PU-N 400 µL

TBX6 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human HGF (Hepatocyte Growth Factor) ELISA Kit
E-EL-H0084-01 24 Tests

Human HGF (Hepatocyte Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Human HGF (Hepatocyte Growth Factor) ELISA Kit
E-EL-H0084-02 48 Tests

Human HGF (Hepatocyte Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Human HGF (Hepatocyte Growth Factor) ELISA Kit
E-EL-H0084-03 96 Tests

Human HGF (Hepatocyte Growth Factor) ELISA Kit

Sign In for Pricing
View Details
Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-,  10nm
GP-2401-10 1 mL

Colloidal Gold Conjugated Griffonia simplicifolia Lectin -GS-I-, 10nm

Sign In for Pricing
View Details