Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2A Peptide - C-terminal region

ACVR2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACVR2, ACTRII

UniProt

P27037

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACVR2A Rabbit Polyclonal Antibody (orb325207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001607

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RLIMP2 Recombinant Protein (Human)
RP086877 100 µg

RLIMP2 Recombinant Protein (Human)

Sign In for Pricing
View Details
CRYBA1 Protein Lysate (Human) with C-Ha Tag
16875031 100 µg

CRYBA1 Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
Profilin 1 protein - Untagged - human recombinant
PR02-A 1x 100 µg

Profilin 1 protein - Untagged - human recombinant

Sign In for Pricing
View Details
C1orf138 Polyclonal Antibody, PE-Cy5 Conjugated
bs-15020R-PE-Cy5 100 µL

C1orf138 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Human Hepatitis B virus X Ag (HBXAg) ELISA Kit
MBS2800364-01 48 Tests

Human Hepatitis B virus X Ag (HBXAg) ELISA Kit

Sign In for Pricing
View Details
Human Hepatitis B virus X Ag (HBXAg) ELISA Kit
MBS2800364-02 96 Tests

Human Hepatitis B virus X Ag (HBXAg) ELISA Kit

Sign In for Pricing
View Details