Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACVR2A Peptide - C-terminal region

ACVR2A Peptide - C-terminal region

Product Specifications

Product Name Alternative

ACVR2, ACTRII

UniProt

P27037

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACVR2A Rabbit Polyclonal Antibody (orb325207) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001607

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AYLHEDIPGLKDGHKPAISHRDIKSKNVLLKNNLTACIADFGLALKFEAG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N- (2-Chloroethyl) -N- (2-hydroxyethyl) Methylamine Picrate
456889-01 5 mg

N- (2-Chloroethyl) -N- (2-hydroxyethyl) Methylamine Picrate

Sign In for Pricing
View Details
N- (2-Chloroethyl) -N- (2-hydroxyethyl) Methylamine Picrate
456889-02 10 mg

N- (2-Chloroethyl) -N- (2-hydroxyethyl) Methylamine Picrate

Sign In for Pricing
View Details
Rat Monoclonal Ly-6B.2 Antibody (7/4) [Biotin]
NBP2-13077B 0.125 mL

Rat Monoclonal Ly-6B.2 Antibody (7/4) [Biotin]

Sign In for Pricing
View Details
Recombinant Caenorhabditis elegans Transitional endoplasmic reticulum ATPase homolog 2 (cdc-48.2), partial
MBS1095468 Inquire

Recombinant Caenorhabditis elegans Transitional endoplasmic reticulum ATPase homolog 2 (cdc-48.2), partial

Sign In for Pricing
View Details
ELISA Kit For Alpha-1A adrenergic receptor
E1298h 96 Tests

ELISA Kit For Alpha-1A adrenergic receptor

Sign In for Pricing
View Details
Vps24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4882907 1.0 µg DNA

Vps24 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details