Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM7SF3 Peptide - middle region

TM7SF3 Peptide - middle region

Product Specifications

UniProt

Q9NS93

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TM7SF3 Rabbit Polyclonal Antibody (orb325328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057635

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

2,4,6-Tribromophenol
TRC-T772610-5G 5 g

2,4,6-Tribromophenol

Sign In for Pricing
View Details
Mouse Evi5 activation kit by CRISPRa
GA201315 1 Kit

Mouse Evi5 activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse IL-18 (Interleukin 18) CLIA Kit
E-CL-M0463-01 24 Tests

Mouse IL-18 (Interleukin 18) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-18 (Interleukin 18) CLIA Kit
E-CL-M0463-02 48 Tests

Mouse IL-18 (Interleukin 18) CLIA Kit

Sign In for Pricing
View Details
Mouse IL-18 (Interleukin 18) CLIA Kit
E-CL-M0463-03 96 Tests

Mouse IL-18 (Interleukin 18) CLIA Kit

Sign In for Pricing
View Details
VAMP1 (NM_199245) Human Over-expression Lysate
LC404313 20 µg

VAMP1 (NM_199245) Human Over-expression Lysate

Sign In for Pricing
View Details