Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TM7SF3 Peptide - middle region

TM7SF3 Peptide - middle region

Product Specifications

UniProt

Q9NS93

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TM7SF3 Rabbit Polyclonal Antibody (orb325328) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_057635

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLKHLQRMVSVPQVKASALKVVTLTANDKTSVSFSSLPGQGVIYNVIVWD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Colon: left
CS507980 5x 5 µm

Frozen Tissue Sections, Colon: left

Sign In for Pricing
View Details
LMO2 Polyclonal Antibody
E-AB-90452-01 60 µL

LMO2 Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 Polyclonal Antibody
E-AB-90452-02 120 µL

LMO2 Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 Polyclonal Antibody
E-AB-90452-03 200 µL

LMO2 Polyclonal Antibody

Sign In for Pricing
View Details
NLRP3 Human Gene Knockout Kit (CRISPR)
KN213623LP 1 Kit

NLRP3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DIR (DIIC18 (7) ), 5x1mg
#60017-5mg 5x 1 mg

DIR (DIIC18 (7) ), 5x1mg

Sign In for Pricing
View Details