NEK11 Peptide - middle region
NEK11 Peptide - middle region
Product Specifications
Product Name Alternative
NEK11
UniProt
Q8NG66
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with NEK11 Rabbit Polyclonal Antibody (orb580578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: QDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMH
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![APC Rat IgG2b, κ Isotype Control[LTF-2]](https://cdn.genprice.uk/products/763/68dd149c061270361e7cf444/imageurl/e-ab-f09843e.webp)
HA723984 100 µL
Complement C3 Recombinant Rabbit monoclonal Antibody
Sign In for Pricing
View Details 
AP22523PU-N 50 µg
Glutathione Peroxidase 3 (GPX3) (102-114) Goat Polyclonal Antibody
Sign In for Pricing
View Details