Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK11 Peptide - middle region

NEK11 Peptide - middle region

Product Specifications

Product Name Alternative

NEK11

UniProt

Q8NG66

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEK11 Rabbit Polyclonal Antibody (orb580578) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: QDNFCIITEYCEGRDLDDKIQEYKQAGKIFPENQIIEWFIQLLLGVDYMH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human ERVMER34-1 activation kit by CRISPRa
GA119232 1 Kit

Human ERVMER34-1 activation kit by CRISPRa

Sign In for Pricing
View Details
TRAF6 (NM_004620) Human Over-expression Lysate
LY401463 100 µg

TRAF6 (NM_004620) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS518897 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Human LOC112267881 activation kit by CRISPRa
GA120009 1 Kit

Human LOC112267881 activation kit by CRISPRa

Sign In for Pricing
View Details
Adap2 Mouse Gene Knockout Kit (CRISPR)
KN500873 1 Kit

Adap2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IDE Human Gene Knockout Kit (CRISPR)
KN420700 1 Kit

IDE Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details