Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFXN3 Peptide - N-terminal region

SFXN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SFXN3

UniProt

Q9BWM7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFXN3 Rabbit Polyclonal Antibody (orb580940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112233

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Soft tissue
CR562452 5 µg

Tissue Total RNA, Soft tissue

Sign In for Pricing
View Details
Human PCX Antibody Pair Set
E-KAB-0460 50 µL & 100 µg

Human PCX Antibody Pair Set

Sign In for Pricing
View Details
3-(Benzoyloxy)propanoic Acid
TRC-B865870-250MG 250 mg

3-(Benzoyloxy)propanoic Acid

Sign In for Pricing
View Details
GALT Human Gene Knockout Kit (CRISPR)
KN402206 1 Kit

GALT Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human PD-L1 (CD274) activation kit by CRISPRa
GA109256 1 Kit

Human PD-L1 (CD274) activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse Naa15 activation kit by CRISPRa
GA210020 1 Kit

Mouse Naa15 activation kit by CRISPRa

Sign In for Pricing
View Details