Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SFXN3 Peptide - N-terminal region

SFXN3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SFXN3

UniProt

Q9BWM7

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SFXN3 Rabbit Polyclonal Antibody (orb580940) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_112233

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEAS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BCAS4 Human Gene Knockout Kit (CRISPR)
KN415772 1 Kit

BCAS4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TOMM20 Antibody
KC-1975-01 50 μL

TOMM20 Antibody

Sign In for Pricing
View Details
TOMM20 Antibody
KC-1975-02 100 µL

TOMM20 Antibody

Sign In for Pricing
View Details
TOMM20 Antibody
KC-1975-03 1 mL

TOMM20 Antibody

Sign In for Pricing
View Details
Mix-n-StainTM STORM CF®750 Antibody Labeling Kit, 1x50ug labeling
#92557 1 Kit

Mix-n-StainTM STORM CF®750 Antibody Labeling Kit, 1x50ug labeling

Sign In for Pricing
View Details
RGS13 (NM_002927) Human Over-expression Lysate
LY419008 100 µg

RGS13 (NM_002927) Human Over-expression Lysate

Sign In for Pricing
View Details