Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KMT5C Peptide - N-terminal region

KMT5C Peptide - N-terminal region

Product Specifications

Product Name Alternative

SUV420H2, Suv4-20h2

UniProt

Q86Y97

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KMT5C Rabbit Polyclonal Antibody (orb325668) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: TLGGWTARYFQSRGPRQEAALKTHVYRYLRAFLPESGFTILPCTRYSMET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SKA1 (NM_001039535) Human Over-expression Lysate
LY422066 100 µg

SKA1 (NM_001039535) Human Over-expression Lysate

Sign In for Pricing
View Details
MTLRP (GHRL) (NM_016362) Human Recombinant Protein
TP306989L 1 mg

MTLRP (GHRL) (NM_016362) Human Recombinant Protein

Sign In for Pricing
View Details
P2Y6 Recombinant Rabbit Monoclonal Antibody [JG37-77]
ET7108-52 100 µL

P2Y6 Recombinant Rabbit Monoclonal Antibody [JG37-77]

Sign In for Pricing
View Details
UBE2S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G2]
TA505186BM 100 µL

UBE2S Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G2]

Sign In for Pricing
View Details
2-Naphthalenecarboxylic Acid-13C6
TRC-N345642-25MG 25 mg

2-Naphthalenecarboxylic Acid-13C6

Sign In for Pricing
View Details
TRIM29 Human Gene Knockout Kit (CRISPR)
KN201916 1 Kit

TRIM29 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details