Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLK3 Peptide - N-terminal region

CLK3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLK3

UniProt

P49761

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLK3 Rabbit Polyclonal Antibody (orb581535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Spink13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3284206 1.0 µg DNA

Spink13 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human Parvovirus IgM Antibody ELISA Kit
MBS3804590-01 48 Well

Human Parvovirus IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Parvovirus IgM Antibody ELISA Kit
MBS3804590-02 96 Well

Human Parvovirus IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Parvovirus IgM Antibody ELISA Kit
MBS3804590-03 5x 96 Well

Human Parvovirus IgM Antibody ELISA Kit

Sign In for Pricing
View Details
Human Parvovirus IgM Antibody ELISA Kit
MBS3804590-04 10x 96 Well

Human Parvovirus IgM Antibody ELISA Kit

Sign In for Pricing
View Details
(3,5-Dimethoxyphenyl) -2-pyridinylmethanone
OR1091890 1 Each

(3,5-Dimethoxyphenyl) -2-pyridinylmethanone

Sign In for Pricing
View Details