Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CLK3 Peptide - N-terminal region

CLK3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CLK3

UniProt

P49761

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CLK3 Rabbit Polyclonal Antibody (orb581535) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AAAGAWETMHHCKRYRSPEPDPYLSYRWKRRRSYSREHEGRLRYPSRREP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vascular Cell Adhesion Molecule 1 (VCAM1) Magnetic Luminex Assay Kit
LKU606099 96 Tests

Vascular Cell Adhesion Molecule 1 (VCAM1) Magnetic Luminex Assay Kit

Sign In for Pricing
View Details
KRTAP4-6 CRISPR All-in-one AAV vector set (with saCas9)(Human)
26190151 3x 1.0 µg DNA

KRTAP4-6 CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
Rcn3 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6515802 1.0 µg DNA

Rcn3 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
VANGL2 Rabbit pAb
E2161210 100 µL

VANGL2 Rabbit pAb

Sign In for Pricing
View Details
TRIM59 Antibody
29-874 100 µL

TRIM59 Antibody

Sign In for Pricing
View Details
TMEM184C Protein Lysate
OCOA09646-20UG 20 µg

TMEM184C Protein Lysate

Sign In for Pricing
View Details