Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN1 Peptide - N-terminal region

SPIN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SPIN1, OCR, SPIN

UniProt

Q9Y657

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPIN1 Rabbit Polyclonal Antibody (orb581634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006708

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPT1B Rabbit Polyclonal Antibody (Fluoro647)
orb3077151 100 µg

CPT1B Rabbit Polyclonal Antibody (Fluoro647)

Sign In for Pricing
View Details
LRRC67, CT (PPP1R42, LRRC67, Protein phosphatase 1 regulatory subunit 42, Leucine-rich repeat-containing protein 67)
037970 200 µL

LRRC67, CT (PPP1R42, LRRC67, Protein phosphatase 1 regulatory subunit 42, Leucine-rich repeat-containing protein 67)

Sign In for Pricing
View Details
Infectious bursal disease virus Pathotyping One-Step PCR kit
Oneq-V589-50R 50T

Infectious bursal disease virus Pathotyping One-Step PCR kit

Sign In for Pricing
View Details
Phospho-Tau Protein (Thr181) Rabbit Polyclonal Antibody (PerCP-Cy5.5)
orb2445477 100 µL

Phospho-Tau Protein (Thr181) Rabbit Polyclonal Antibody (PerCP-Cy5.5)

Sign In for Pricing
View Details
Fluorene-9-carboxylic acid amide
sc-269200 100 mg

Fluorene-9-carboxylic acid amide

Sign In for Pricing
View Details
SLC20A2 Blocking Peptide
33R-2221 100 ug

SLC20A2 Blocking Peptide

Sign In for Pricing
View Details