Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN1 Peptide - N-terminal region

SPIN1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SPIN1, OCR, SPIN

UniProt

Q9Y657

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPIN1 Rabbit Polyclonal Antibody (orb581634) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006708

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-DAGLB Antibody, Affinity Purified
MBS3904655-01 0.01 mg

Rabbit anti-DAGLB Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DAGLB Antibody, Affinity Purified
MBS3904655-02 0.1 mg

Rabbit anti-DAGLB Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DAGLB Antibody, Affinity Purified
MBS3904655-03 5x 0.01 mg

Rabbit anti-DAGLB Antibody, Affinity Purified

Sign In for Pricing
View Details
Rabbit anti-DAGLB Antibody, Affinity Purified
MBS3904655-04 5x 0.1 mg

Rabbit anti-DAGLB Antibody, Affinity Purified

Sign In for Pricing
View Details
Lentiviral human TIPRL shRNA (UAS) - Lentiviral human TIPRL shRNA (UAS, RFP) plasmid
GTR15341608 1 Vial

Lentiviral human TIPRL shRNA (UAS) - Lentiviral human TIPRL shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
GLP1 -Cys, GLP1 -Cys Peptide
abx266278-01 5 mg

GLP1 -Cys, GLP1 -Cys Peptide

Sign In for Pricing
View Details