Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB2 Peptide - C-terminal region

TOB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOB2, KIAA1663, TOB4, TROB2

UniProt

Q14106

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB2 Rabbit Polyclonal Antibody (orb581680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006724168

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GDNF (NM_199234) Human Over-expression Lysate
LC403702 20 µg

GDNF (NM_199234) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Gdf1 activation kit by CRISPRa
GA201579 1 Kit

Mouse Gdf1 activation kit by CRISPRa

Sign In for Pricing
View Details
Arl13b Mouse Gene Knockout Kit (CRISPR)
KN501563 1 Kit

Arl13b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD134, Mouse (OX40) (OX-86), 1mg/mL
BNUM2004-50 1x 50 µL

CD134, Mouse (OX40) (OX-86), 1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Ovary: bilateral
CR562481 5 µg

Tissue Total RNA, Ovary: bilateral

Sign In for Pricing
View Details
Variable Volume 8 Channel Micropipette BPIP-306
BPIP-306 1 Unit

Variable Volume 8 Channel Micropipette BPIP-306

Sign In for Pricing
View Details