Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOB2 Peptide - C-terminal region

TOB2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

TOB2, KIAA1663, TOB4, TROB2

UniProt

Q14106

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TOB2 Rabbit Polyclonal Antibody (orb581680) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_006724168

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LSMHSLNFITANPAPQSQLSPNAKEFVYNGGGSPSLFFDAADGQGSGTPG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDS2 Antibody
KC-41924-01 50 μL

CDS2 Antibody

Sign In for Pricing
View Details
CDS2 Antibody
KC-41924-02 100 µL

CDS2 Antibody

Sign In for Pricing
View Details
CDS2 Antibody
KC-41924-03 1 mL

CDS2 Antibody

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD45RA Antibody[HI100]
E-AB-F1052M-01 20 Tests

Elab Fluor® 647 Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD45RA Antibody[HI100]
E-AB-F1052M-02 100 Tests

Elab Fluor® 647 Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD45RA Antibody[HI100]
E-AB-F1052M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD45RA Antibody[HI100]

Sign In for Pricing
View Details