CREM Peptide - middle region
CREM Peptide - middle region
Product Specifications
Product Name Alternative
CREM
UniProt
Q03060
Field of Research
Stem Cell & Developmental Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CREM Rabbit Polyclonal Antibody (orb330714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: GVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYTATGDMPTYQIRAP
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6340577-01 0.2 mL
RB1, ID (Retinoblastoma-associated protein, PP110, P105-RB, RB, RB1,) (Biotin)
Sign In for Pricing
View Details MBS6340577-02 5x 0.2 mL
RB1, ID (Retinoblastoma-associated protein, PP110, P105-RB, RB, RB1,) (Biotin)
Sign In for Pricing
View Details MBS1302679-01 0.02 mg (E-Coli)
Recombinant Pseudomonas aeruginosa Uncharacterized protein PA1579 (PA1579)
Sign In for Pricing
View Details MBS1302679-02 0.1 mg (E-Coli)
Recombinant Pseudomonas aeruginosa Uncharacterized protein PA1579 (PA1579)
Sign In for Pricing
View Details MBS1302679-03 0.02 mg (Yeast)
Recombinant Pseudomonas aeruginosa Uncharacterized protein PA1579 (PA1579)
Sign In for Pricing
View Details