Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CREM Peptide - middle region

CREM Peptide - middle region

Product Specifications

Product Name Alternative

CREM

UniProt

Q03060

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CREM Rabbit Polyclonal Antibody (orb330714) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYTATGDMPTYQIRAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YsaB Antibody
orb836164 2 mg

YsaB Antibody

Sign In for Pricing
View Details
GBP1 (E99) polyclonal antibody
orb643862-01 25 µL

GBP1 (E99) polyclonal antibody

Sign In for Pricing
View Details
GBP1 (E99) polyclonal antibody
orb643862-02 50 μL

GBP1 (E99) polyclonal antibody

Sign In for Pricing
View Details
GBP1 (E99) polyclonal antibody
orb643862-03 100 µL

GBP1 (E99) polyclonal antibody

Sign In for Pricing
View Details
GBP1 (E99) polyclonal antibody
orb643862-04 200 µL

GBP1 (E99) polyclonal antibody

Sign In for Pricing
View Details
RPS26P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
LV784410 1.0 µg DNA

RPS26P27 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)

Sign In for Pricing
View Details