Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTS Peptide - N-terminal region

PTS Peptide - N-terminal region

Product Specifications

Product Name Alternative

PTPS

UniProt

Q03393

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTS Rabbit Polyclonal Antibody (orb326073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000308

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

USP9X Human Gene Knockout Kit (CRISPR)
KN217531 1 Kit

USP9X Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Linarine
TRC-L466050-5MG 5 mg

Linarine

Sign In for Pricing
View Details
Phenolphthalein (0.04% Solution in Ethanol)
TRC-P318011-50ML 50 mL

Phenolphthalein (0.04% Solution in Ethanol)

Sign In for Pricing
View Details
Glutamyl Lysine gamma (Isopeptide) Mouse Monoclonal Antibody [Clone ID: 81D4]
AM10189PU-N 100 µg

Glutamyl Lysine gamma (Isopeptide) Mouse Monoclonal Antibody [Clone ID: 81D4]

Sign In for Pricing
View Details
MEK4 (MAP2K4) pThr261 Rabbit Polyclonal Antibody
AP02453PU-N 100 µL

MEK4 (MAP2K4) pThr261 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human SLC6A7 activation kit by CRISPRa
GA104458 1 Kit

Human SLC6A7 activation kit by CRISPRa

Sign In for Pricing
View Details