Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTS Peptide - N-terminal region

PTS Peptide - N-terminal region

Product Specifications

Product Name Alternative

PTPS

UniProt

Q03393

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTS Rabbit Polyclonal Antibody (orb326073) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_000308

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SKFLSDEENLKLFGKCNNPNGHGHNYKVVVTVHGEIDPATGMVMNLADLK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Polystyrene A PHB
HA25031513.100G 100 g

Polystyrene A PHB

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR562773 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
Rat IgG (Immunoglobulin G) ELISA Kit
E-EL-R0518-01 24 Tests

Rat IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
Rat IgG (Immunoglobulin G) ELISA Kit
E-EL-R0518-02 48 Tests

Rat IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
Rat IgG (Immunoglobulin G) ELISA Kit
E-EL-R0518-03 96 Tests

Rat IgG (Immunoglobulin G) ELISA Kit

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL
BNC680669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details