Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PARVG Peptide - C-terminal region

PARVG Peptide - C-terminal region

Product Specifications

Product Name Alternative

PARVG

UniProt

Q9HBI0

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PARVG Rabbit Polyclonal Antibody (orb326221) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005261759

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLLLIGQLEGFFLHLKEFYLTPNSPAEMLHNVTLALELLKDEGLLSCPVS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat GRP78 (Glucose Regulated Protein 78) ELISA Kit
ELK6834-01 48 Tests

Rat GRP78 (Glucose Regulated Protein 78) ELISA Kit

Sign In for Pricing
View Details
Rat GRP78 (Glucose Regulated Protein 78) ELISA Kit
ELK6834-02 96 Tests

Rat GRP78 (Glucose Regulated Protein 78) ELISA Kit

Sign In for Pricing
View Details
Rat GRP78 (Glucose Regulated Protein 78) ELISA Kit
ELK6834-03 5x 96 Tests

Rat GRP78 (Glucose Regulated Protein 78) ELISA Kit

Sign In for Pricing
View Details
Fyn (Ab-530) Antibody
orb127409-01 25 µg

Fyn (Ab-530) Antibody

Sign In for Pricing
View Details
Fyn (Ab-530) Antibody
orb127409-02 50 µg

Fyn (Ab-530) Antibody

Sign In for Pricing
View Details
Fyn (Ab-530) Antibody
orb127409-03 100 µg

Fyn (Ab-530) Antibody

Sign In for Pricing
View Details