GCFC2 Peptide - N-terminal region
GCFC2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GCFC2, C2orf3, GCF, TCF9
UniProt
P16383
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GCFC2 Rabbit Polyclonal Antibody (orb583861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003194
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]](https://cdn.genprice.uk/products/937/68dd18b9061270361e907f4d/imageurl/cf806789.webp)
CF806789 100 µg
Dishevelled 2 (DVL2) Mouse Monoclonal Antibody [Clone ID: OTI7C7]
Sign In for Pricing
View Details 
BNC742927-500 1x 500 µL
MSH6 (DNA Mismatch Repair Protein) (MSH6/2927), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
![PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]](https://cdn.genprice.uk/products/763/68dd14a1061270361e7d091d/imageurl/e-ab-f0990h.webp)
E-AB-F0990H-01 50 Tests
PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
Sign In for Pricing
View Details E-AB-F0990H-02 100 Tests
PE/Cyanine7 Anti-Mouse MHC II (I-A/I-E) Antibody[M5/114]
Sign In for Pricing
View Details