GCFC2 Peptide - N-terminal region
GCFC2 Peptide - N-terminal region
Product Specifications
Product Name Alternative
GCFC2, C2orf3, GCF, TCF9
UniProt
P16383
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GCFC2 Rabbit Polyclonal Antibody (orb583861) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_003194
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MKRESEDDPESEPDDHEKRIPFTLRPQTLRQRMAEESISRNEETSEESQE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNCB0446-100 1x 100 µL
Cytokeratin, HMW (34BE12), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![Elab Fluor® 488 Anti-Mouse CD22 Antibody[Cy34.1]](https://cdn.genprice.uk/products/763/68dd14b2061270361e7d42ac/imageurl/e-ab-f1021l.webp)
E-AB-F1021L-01 50 Tests
Elab Fluor® 488 Anti-Mouse CD22 Antibody[Cy34.1]
Sign In for Pricing
View Details E-AB-F1021L-02 100 Tests
Elab Fluor® 488 Anti-Mouse CD22 Antibody[Cy34.1]
Sign In for Pricing
View Details E-AB-F1021L-03 2x 100 Tests
Elab Fluor® 488 Anti-Mouse CD22 Antibody[Cy34.1]
Sign In for Pricing
View Details 
