Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DPPA3 Peptide - N-terminal region

DPPA3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DPPA3, STELLAR

UniProt

Q6W0C5

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DPPA3 Rabbit Polyclonal Antibody (orb584131) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_954980

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DPSQFNPTYIPGSPQMLTEENSRDDSGASQISSETLIKNLSNLTINASSE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Anti-Human CD106-PE
31-3338-100 100 Tests

Mouse Anti-Human CD106-PE

Sign In for Pricing
View Details
FMO5 Protein Lysate (Rat) with C-HA Tag
20696036 100 µg

FMO5 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Transferrin Mouse mAb Antibody
orb763544-01 50 μL

Transferrin Mouse mAb Antibody

Sign In for Pricing
View Details
Transferrin Mouse mAb Antibody
orb763544-02 100 µL

Transferrin Mouse mAb Antibody

Sign In for Pricing
View Details
Alpha-1-microglobulin monoclonal antibody
10R-11525 1 mg

Alpha-1-microglobulin monoclonal antibody

Sign In for Pricing
View Details
RGS20 Antibody
A33164-100UL 100 µL

RGS20 Antibody

Sign In for Pricing
View Details