Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3A Peptide - C-terminal region

APOBEC3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3A, APOBEC3A

UniProt

P31941

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3A Rabbit Polyclonal Antibody (orb326395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005277017

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NGFR Mouse mAb
64002 100 µL

NGFR Mouse mAb

Sign In for Pricing
View Details
Rat Thrombopoietin receptor ELISA Kit
GTR10318431 96 Well

Rat Thrombopoietin receptor ELISA Kit

Sign In for Pricing
View Details
SALL4 (Sal-like Protein 4, HSAL4, dJ1112F19.1, DRRS, Zinc Finger Protein 797, ZNF797, Zinc Finger Protein SALL4) (MaxLight 490)
132956-ML490 100 µL

SALL4 (Sal-like Protein 4, HSAL4, dJ1112F19.1, DRRS, Zinc Finger Protein 797, ZNF797, Zinc Finger Protein SALL4) (MaxLight 490)

Sign In for Pricing
View Details
Mouse COL2-Collagen Type Ⅱ- ELISA Kit
E-EL-M0374-01 24 Tests

Mouse COL2-Collagen Type Ⅱ- ELISA Kit

Sign In for Pricing
View Details
Mouse COL2-Collagen Type Ⅱ- ELISA Kit
E-EL-M0374-02 48 Tests

Mouse COL2-Collagen Type Ⅱ- ELISA Kit

Sign In for Pricing
View Details
Mouse COL2-Collagen Type Ⅱ- ELISA Kit
E-EL-M0374-03 96 Tests

Mouse COL2-Collagen Type Ⅱ- ELISA Kit

Sign In for Pricing
View Details