Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

APOBEC3A Peptide - C-terminal region

APOBEC3A Peptide - C-terminal region

Product Specifications

Product Name Alternative

A3A, APOBEC3A

UniProt

P31941

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with APOBEC3A Rabbit Polyclonal Antibody (orb326395) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005277017

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AQVSIMTYDEFKHCWDTFVDHQGCPFQPWDGLDEHSQALSGRLRAILQNQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AMP Buffer 0.2M, pH 9.0
40120022-4 1 L

AMP Buffer 0.2M, pH 9.0

Sign In for Pricing
View Details
Malaria Pf/Pan Antigen Rapid Test
21 40 Tests/Kit

Malaria Pf/Pan Antigen Rapid Test

Sign In for Pricing
View Details
1,3-bis (2-methoxyphenyl) -5- ((3,4-dimethoxyphenyl) methylene) -1,3-diazaperhydroine-2,4,6-trione
NMA49914 250 mg

1,3-bis (2-methoxyphenyl) -5- ((3,4-dimethoxyphenyl) methylene) -1,3-diazaperhydroine-2,4,6-trione

Sign In for Pricing
View Details
SARS-CoV-2 Spike Glycoprotein Antibody
abx461642-01 100 µg

SARS-CoV-2 Spike Glycoprotein Antibody

Sign In for Pricing
View Details
SARS-CoV-2 Spike Glycoprotein Antibody
abx461642-02 1 mg

SARS-CoV-2 Spike Glycoprotein Antibody

Sign In for Pricing
View Details
H3R-IN-1 Hydrochloride
T11531-01 25 mg

H3R-IN-1 Hydrochloride

Sign In for Pricing
View Details