Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPVL Peptide - C-terminal region

CPVL Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPVL, VLP, PSEC0124, UNQ197/PRO223

UniProt

Q9H3G5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPVL Rabbit Polyclonal Antibody (orb585108) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005249843

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIM1 Rabbit Polyclonal Antibody (BF350)
orb2542915 100 µL

SIM1 Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
RGD1565459 3'UTR Luciferase Stable Cell Line
TU219179 1.0 mL

RGD1565459 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
CD71 (YTA 74.4) Alexa Fluor® 680
sc-59112 AF680 200 µg/mL

CD71 (YTA 74.4) Alexa Fluor® 680

Sign In for Pricing
View Details
Ppp1r3d sgRNA CRISPR Lentivector (Mouse) (Target 2)
K3202303 1.0 µg DNA

Ppp1r3d sgRNA CRISPR Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Interleukin 18 (IL18) Antibody
abx131943-01 100 µL

Interleukin 18 (IL18) Antibody

Sign In for Pricing
View Details
Interleukin 18 (IL18) Antibody
abx131943-02 200 µL

Interleukin 18 (IL18) Antibody

Sign In for Pricing
View Details