Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CPVL Peptide - C-terminal region

CPVL Peptide - C-terminal region

Product Specifications

Product Name Alternative

CPVL, VLP, PSEC0124, UNQ197/PRO223

UniProt

Q9H3G5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CPVL Rabbit Polyclonal Antibody (orb585108) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005249843

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: MGMDWKGSQEYKKAEKKVWKIFKSDSEVAGYIRQAGDFHQVIIRGGGHIL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm3985 Protein Vector (Mouse) (pPB-C-His)
PV183910 500 ng

Gm3985 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
IKKβ polyclonal antibody
orb1717294-01 50 µL

IKKβ polyclonal antibody

Sign In for Pricing
View Details
IKKβ polyclonal antibody
orb1717294-02 100 µL

IKKβ polyclonal antibody

Sign In for Pricing
View Details
4-Propylpyridine
OR13622-01 500 mg

4-Propylpyridine

Sign In for Pricing
View Details
4-Propylpyridine
OR13622-02 1 g

4-Propylpyridine

Sign In for Pricing
View Details
Cavy Distal Less Homeobox 5 ELISA Kit
MBS042031 Inquire

Cavy Distal Less Homeobox 5 ELISA Kit

Sign In for Pricing
View Details