Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TACR2 Peptide - C-terminal region

TACR2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

SKR, NK2R, NKNAR, TAC2R

UniProt

P21452

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TACR2 Rabbit Polyclonal Antibody (orb326575) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001048

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ELTPTTSLSTRVNRCHTKETLFMAGDTAPSEATSGEAGRPQDGSGLWFGY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FKBP12 (FKBP1A) (NM_000801) Human Over-expression Lysate
LY400279 100 µg

FKBP12 (FKBP1A) (NM_000801) Human Over-expression Lysate

Sign In for Pricing
View Details
Human TMPRSS11A activation kit by CRISPRa
GA117451 1 Kit

Human TMPRSS11A activation kit by CRISPRa

Sign In for Pricing
View Details
CF®680 Goat Anti-Mouse IgG3 (γ3), 2mg/mL
#20931-250uL 1x 250 µL

CF®680 Goat Anti-Mouse IgG3 (γ3), 2mg/mL

Sign In for Pricing
View Details
Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF740 conjugate, 0.1mg/mL
BNC742000-500 1x 500 µL

Mammaglobin (SCGB2A2) (Breast Cancer Marker) (MGB1/2000), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS706490 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human Angiomotin like 1 (AMOTL1) activation kit by CRISPRa
GA115900 1 Kit

Human Angiomotin like 1 (AMOTL1) activation kit by CRISPRa

Sign In for Pricing
View Details