ARHGAP27 Peptide - middle region
ARHGAP27 Peptide - middle region
Product Specifications
Product Name Alternative
PP905, SH3D20, SH3P20, CAMGAP1
UniProt
Q6ZUM4
Field of Research
Signal Transduction
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ARHGAP27 Rabbit Polyclonal Antibody (orb326654) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SQDKQMLYTNHFTQEQVPVPAPRSIHKSSQDGDTPAQASPPEEKVPAELD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC401967-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (rTGB24), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![FAM151B Mouse Monoclonal Antibody [Clone ID: OTI1F5]](https://cdn.genprice.uk/products/937/68dd18bb061270361e908b55/imageurl/cf811466.webp)
CF811466 100 µg
FAM151B Mouse Monoclonal Antibody [Clone ID: OTI1F5]
Sign In for Pricing
View Details 
PKSR030378 100 µg
Recombinant Rat PRLR/Prolactin Receptor Protein (His Tag)
Sign In for Pricing
View Details 
