Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA10 Peptide - N-terminal region

NDUFA10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-42k, CI-42KD

UniProt

O95299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA10 Rabbit Polyclonal Antibody (orb327248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004535

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Endometriotic tissue
CS801549 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details
ACSL5 (NM_203380) Human Over-expression Lysate
LC404322 20 µg

ACSL5 (NM_203380) Human Over-expression Lysate

Sign In for Pricing
View Details
Diethyl (S)-2-Amino-2-oxoethyl Phosphonate Afatinib
TRC-D355300-250MG 250 mg

Diethyl (S)-2-Amino-2-oxoethyl Phosphonate Afatinib

Sign In for Pricing
View Details
Human uPAR Mouse monoclonal Antibody
HA601437 100 µg

Human uPAR Mouse monoclonal Antibody

Sign In for Pricing
View Details
PACRG (NM_001080378) Human Over-expression Lysate
LY421606 100 µg

PACRG (NM_001080378) Human Over-expression Lysate

Sign In for Pricing
View Details
Otos (NM_153114) Mouse Tagged ORF Clone
MG200221 10 µg

Otos (NM_153114) Mouse Tagged ORF Clone

Sign In for Pricing
View Details