Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NDUFA10 Peptide - N-terminal region

NDUFA10 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CI-42k, CI-42KD

UniProt

O95299

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NDUFA10 Rabbit Polyclonal Antibody (orb327248) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004535

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EKFYDDPRSNDGNSYRLQSWLYSSRLLQYSDALEHLLTTGQGVVLERSIF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5beta-Pregnane-3alpha,20alpha-diol-d5
TRC-P705132-1MG 1 mg

5beta-Pregnane-3alpha,20alpha-diol-d5

Sign In for Pricing
View Details
SLC7A4 (NM_004173) Human Over-expression Lysate
LY401343 100 µg

SLC7A4 (NM_004173) Human Over-expression Lysate

Sign In for Pricing
View Details
Human ABHD6 activation kit by CRISPRa
GA111483 1 Kit

Human ABHD6 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant ELK1 Antibody
RC-4670-01 50 μL

Recombinant ELK1 Antibody

Sign In for Pricing
View Details
Recombinant ELK1 Antibody
RC-4670-02 100 µL

Recombinant ELK1 Antibody

Sign In for Pricing
View Details
Recombinant ELK1 Antibody
RC-4670-03 1 mL

Recombinant ELK1 Antibody

Sign In for Pricing
View Details