Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NEK2 Peptide - C-terminal region

NEK2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

NEK2, NEK2A, NLK1

UniProt

P51955

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with NEK2 Rabbit Polyclonal Antibody (orb588140) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLKDYHRPSVEEILENPLIADLVADEQRRNLERRGRQLGEPEKSQDSSPV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

S100A3 Human Gene Knockout Kit (CRISPR)
KN202117RB 1 Kit

S100A3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PLPP6 (NM_203453) Human Over-expression Lysate
LC403715 20 µg

PLPP6 (NM_203453) Human Over-expression Lysate

Sign In for Pricing
View Details
Propargyl Bromide (Stablized with MgO)
TRC-P762575-50G 50 g

Propargyl Bromide (Stablized with MgO)

Sign In for Pricing
View Details
Lansoprazole N-Oxide
TRC-L175035-5MG 5 mg

Lansoprazole N-Oxide

Sign In for Pricing
View Details
Calpain 1 Antibody
KC-19937-01 50 μL

Calpain 1 Antibody

Sign In for Pricing
View Details
Calpain 1 Antibody
KC-19937-02 100 µL

Calpain 1 Antibody

Sign In for Pricing
View Details